antenna alignment using pc seminar full report ....etc

[:=Read Full Message Here=:]

Abstract;
In order to examine the validity of model at organic/metal interfaces, the position of the vacuum level of N,N'-bis(3-methylphenyl)-N,N'-diphenyl--4,4'-diamine (TPD) film formed on various metal substrates (Au, Cu, Ag, Mg and Ca) was measured as a function of the film-thickness by Kelvin probe method in ultrahigh vacuum (UHV). TPD is a typical hole-injecting material for organic electroluminescent devices. At all the interfaces, sharp shifts of the vacuum level were observed within 1 nm thickness. Further deposition o ....etc

[:=Read Full Message Here=:]

sir i m interested to learn and see the girth gear alignment of kiln and mill girth gear. ....etc

[:=Read Full Message Here=:]

Sequence 1:
>gi|150393488|ref|YP_001316163.1| globin
MTTTPYDIIGKEALYDMIDYFYTLVEKDERLNHLFPGDFAETSRKQKQFLTQFLGGPNIYTEEHGHPMLRKRHMDFTITEFERDAWLENMQTAINRAAFPQGVGDYLFERLRLTANHMVNS
Sequence 2:
>gi|57637203|gb|AAW53991.1| protozoan/cyanobacterial globin family protein
MSIRQITFKCKNSCYIRYILMEHGDIMSKTPYELIGQKALYQMIDHFYQLVEKDSRINHLFPGDFKETSRKQKQFLTQFLGGPDLYTQEHGHPMLKRRHMEFTISEYERDAWLENMHTAIQHAELPAGVGDYLFERLRLTAHHMVNS
Theory:
• ....etc

[:=Read Full Message Here=:]

Sequence 1:
>gi|6321538|ref|NP_011615.1| Pcp1p
MSGVSSVMLGLRPATRIFFRSNISVSPSRTFVSYIGRSQSTSILKNAPNLEDNVTNLQKIIPKRFFSQTSILKSRWKPIFNEETTNRYVRLNRFQQYQQQRSGGNPLGSMTILGLSLMAGIYFGSPYLFEHVPPFTYFKTHPKNLVYALLGINVAVFGLWQLPKCWRFLQKYMLLQKDYVTSKISIIGSAFSHQEFWHLGMNMLALWSFGTSLATMLGASNFFSLYMNSAIAGSLFSLWYPKLARLAIVGPSLGASGALFGVLGCFSYLFPHAKILLFVFPVPGGAWVAFLASVAWNAAGCALRWGSFDYAAHLGGSMMGVLYGWYISKAVEKQRQRRLQAAGRWF
Sequence 2:
>sp|P48740|MASP1_HUMAN Mannan-binding lectin serine protease 1 OS=Homo ....etc

[:=Read Full Message Here=:]

Abstract—Dramatic increase in the number of academic publications has led to growing demand for efficient organization of the resources to meet researchers' needs. As a result, a number of network services have compiled databases from the public resources scattered over the Internet. However, publications by different conferences and journals adopt different citation styles. It is an interesting problem to accurately extract metadata from a citation string which is formatted in one of thousands of different styles. It has attracted a great de ....etc

[:=Read Full Message Here=:]

Abstract
Microwave Antenna Alignment
For Transmission of data or Speech in wireless communication Microwave Antennas are getting more popular instead of Optical Fiber due to their reliability. This project deals with the Installing and commissioning of series microwave product hardware. It consist of five modules
Engineering preparation and unpacking check
Installing the Antenna
Installing the ODU and IF cable
Installing the IDU unit
Commissioning of the equipment
On doing with th ....etc

[:=Read Full Message Here=:]

Sequence 1:
>gi|44955888|ref|NP_976312.1| myoglobin
MGLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASEDLKKHGATVLTALGGILKKKGHHEAEIKPLAQSHATKHKIPVKYLEFISECIIQVLQSKHPGDFGADAQGAMNKALELFRKDMASNYKELGFQG
Sequence 2:
>gi|21359820|ref|NP_038621.2| myoglobin
MGLSDGEWQLVLNVWGKVEADLAGHGQEVLIGLFKTHPETLDKFDKFKNLKSEEDMKGSEDLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEIIIEVLKKRHSGDFGADAQGAMSKALELFRNDIAAKYKELGFQG
Sequence 3:
>gi|11024650|ref|NP_067599.1| myoglobin [Ra ....etc

[:=Read Full Message Here=:]

Web Server for High Performance Biological Sequence Alignment Based on FPGA
An FPGA-based web server for biological sequence alignment is presented in this article. The FPGA cores used in this server are highly parameterisable, scalable, and platform-independent. Te main components of the web server are :
-an HTML–based interface
-a MySQL database for holding the user queries and results.
-a library of FPGA configurations
-a host application servicing user requests
-an FPGA coprocessor which is used for the purpose of accelerat ....etc

[:=Read Full Message Here=:]

Wheel alignment. I need future scope of that
....etc

[:=Read Full Message Here=:]