Abstract—Tree is one of the most common and well-studied data structures in computer science. Measuring the similarity of such structures is key to analyzing this type of data. However, measuring tree similarity is not trivial due to the inherent complexity of trees and the ensuing large search space. Tree kernel, a state of the art similarity measurement of trees, represents trees as vectors in a feature space and measures similarity in this space. When different features are used, different algorithms are required. Tree edit distance is ano ....etc

[:=Read Full Message Here=:]

To support the retrieval, fusion and discovery of visual/multimedia information, a spatial query language for multiple data sources is needed. In this paper we describe a spatial query language interpreter which is based upon the a-operator sequence and in practice expressible in an SQL-like syntax. The algorithm for the a-query translator is explored in detail. The implementation of the algorithm including data structures, pseudo-codes and source codes in C is presented. Query examples handled successfully by the a-query implementation are als ....etc

[:=Read Full Message Here=:]

A Fuzzy Similarity Approach for Automated Spam Filtering –IEEE –java

Abstract:
E-mail spam has become an epidemic problem that can negatively affect the usability of electronic mail as a communication means. Besides wasting users’ time and effort to scan and delete the massive amount of
junk e-mails received; it consumes network bandwidth and storage space, slows down e-mail servers, and provides a medium to distribute harmful and/or offensive content. Several machine learning approaches have been applied to this problem. In ....etc

[:=Read Full Message Here=:]

i want source code and seminar on multiple consumers and multiple producers in operating system,plz help anyone kindly,and post it by wednesday plzzzzzzzzzz ....etc

[:=Read Full Message Here=:]

CHAPTER – 1
INTRODUCTION
E-mail spam has continued to increase at a very fast rate over the last couple of years. It has become a major threat for business users, network administrators and even normal users. A study in July 1997 reported that spam messages constituted approximately 10% of the incoming messages to a corporate network.
More recently, Message Labs stated in its 2006 Annual Security Report that spam activity has Increased significantly in 2006 with levels that reach 86.2% ....etc

[:=Read Full Message Here=:]

i want the pdf a web search engine based approach to measure semantic similarity between words pdf free download
a web search engine based approach to measure semantic similarity between words ....etc

[:=Read Full Message Here=:]

The dream of every communication designer is to provide good quality service to each of his customer within the limited available bandwidth. But in the recent years, the amount of data flowing through the channel has increased. But there has been no such high increase in the available bandwidth. So it is a challenge to effectively utilize the channel spectrum along with providing good quality of service across wireless links. One of the possible ways is to use multiple antennas at both the ends of the transmission link. MIMP exploits natural ph ....etc

[:=Read Full Message Here=:]

Objective
Program in “LEX” to count number of Characters, Words, Lines.

%{
int nchar=0,nword=0,nline=0;
#include
%}
%%
\n {nline++;nchar++;}
+ {nword++;nchar+=yyleng;}
. {nchar++;}
%%
int main()
{
yylex();
printf(%d%d%d,nchar,nword,nline);
}
....etc

[:=Read Full Message Here=:]

Sequence 1:
>gi|44955888|ref|NP_976312.1| myoglobin
MGLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASEDLKKHGATVLTALGGILKKKGHHEAEIKPLAQSHATKHKIPVKYLEFISECIIQVLQSKHPGDFGADAQGAMNKALELFRKDMASNYKELGFQG
Sequence 2:
>gi|21359820|ref|NP_038621.2| myoglobin
MGLSDGEWQLVLNVWGKVEADLAGHGQEVLIGLFKTHPETLDKFDKFKNLKSEEDMKGSEDLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEIIIEVLKKRHSGDFGADAQGAMSKALELFRNDIAAKYKELGFQG
Sequence 3:
>gi|11024650|ref|NP_067599.1| myoglobin [Ra ....etc

[:=Read Full Message Here=:]

hi,
i was working on a project where we have two sets of telephone lines( one working and other stand by). when ever the primary line fails, the stand by is connected. I wanted to know can we do the change over between the two lines electronically without using mechanical relay. if possible then how?? ....etc

[:=Read Full Message Here=:]