Objective
Program in “LEX” to count the verb in a given line of text.

%{
%}
%%
isI
areI
amI printf(%s is verb,yytext );
+ {printf(%s is not a verb,yytext);}
.I\n {ECHO;}
%%
main()
{
yylex();
}
....etc

[:=Read Full Message Here=:]

Aim:
To write a C# program to perform encryption and decryption of the given data.

Algorithm
ALGORITHM FOR ENCRYPTION:
Step 1: Declare the class as encrypt_class.
Step 2: Start the main function.
Step 3: Declare the variable str in string data type.
Step 4: Create the object for inbuild encryption
algorithm TripleDESCryptoServiceProvider.
Step 5: Create the data file using Filestream
class.
Step 6: Create the object for class cryptoStream.
Cryptostream is a class to ....etc

[:=Read Full Message Here=:]

#include
#include
short x;
void dft(short *x, short k, int *out); //function prototype
#define N 8 //number of data values
float pi = 3.1416;
int sumRe,sumIm;
short x = {1,2,3,4,5,6,7,8}; //1-cycle cosine
int out = {0,0};
int real,imag,k=0; //init Re and Im results
void dft(short *x, short k, int *out) //DFT function
{
int sumRe = 0, sumIm = 0; //init real/imag components
float cs = 0, sn = 0; //init cosine/sine components
int i = 0;
for (i = 0; i < N; i++) //for N-point DFT
{
cs = cos(2* ....etc

[:=Read Full Message Here=:]

Algorithm:-
begin
if a,e,I,o,u or A,E,I,O,U
then
printf “It is a vowel”
else
printf “It is a consonant”
end

1. LEX program to count number of vowels and consonants in a given input string

%%
{printf(“it is vowel”);}
{printf(“it is consonant”);}
%%
main()
{
yylex();
}
int yywrap()
{
return 1;
}


Output:

$./a.out
a
it is a vowel
g
it is a consonant
....etc

[:=Read Full Message Here=:]

Procedure:-
1. Rewrite the difference equation so that y and its delayed samples are on the LHS
2. Create a matrix a for the coefficients of y and its delayed versions
3. Create a matrix b for the coefficients of x and its delayed versions
4. Generate impulse excitation signal delta
5. Find the response h of the filter defined by a & b coefficients , so the input impulse excitation , using filter command
6. Display the impulse response h.
MATLAB program for impulse response
clear
close all
clc ....etc

[:=Read Full Message Here=:]

Whats up people
As a result I've been experience quite down the past a couple of months now. Been to do with Effexor in addition to Mirtazapine without any subsequent results. Been about Valdoxane for about a couple weeks at this time, no effect nevertheless.

The end couple of months I feeling very strange in truth. As a former in depressive disorder spells ahead of, but this method is substantially many. Currently I know like Freezing not have a energy to talk with individuals or hang out with contacts. Right after i do tell myself to g ....etc

[:=Read Full Message Here=:]

Expert system to prescribe the medicines for
the given symptoms

Expert system to prescribe the medicines for
the given symptoms
....etc

[:=Read Full Message Here=:]

Does anyone know that Peritoneal Mesothelioma Symptoms do not show themselves until 10 to 50 years after exposure to asbestos? For more details you can visit it here. ....etc

[:=Read Full Message Here=:]

Sequence 1:
>gi|6321538|ref|NP_011615.1| Pcp1p
MSGVSSVMLGLRPATRIFFRSNISVSPSRTFVSYIGRSQSTSILKNAPNLEDNVTNLQKIIPKRFFSQTSILKSRWKPIFNEETTNRYVRLNRFQQYQQQRSGGNPLGSMTILGLSLMAGIYFGSPYLFEHVPPFTYFKTHPKNLVYALLGINVAVFGLWQLPKCWRFLQKYMLLQKDYVTSKISIIGSAFSHQEFWHLGMNMLALWSFGTSLATMLGASNFFSLYMNSAIAGSLFSLWYPKLARLAIVGPSLGASGALFGVLGCFSYLFPHAKILLFVFPVPGGAWVAFLASVAWNAAGCALRWGSFDYAAHLGGSMMGVLYGWYISKAVEKQRQRRLQAAGRWF
Sequence 2:
>sp|P48740|MASP1_HUMAN Mannan-binding lectin serine protease 1 OS=Homo ....etc

[:=Read Full Message Here=:]

Name– study of Boolean equations using the given ICs.
Aim – to study the manipulation of given equation into an equivalent logic circuit.
Apparatus – required ICs, circuit board, power supply +5V DC, LED, connecting wires, soldering iron, cutter etc.
Circuit diagram –
Draw the logic diagram of given equation (using basic gates only)
on left page of practical record book
with pin numbers of gates and output equation.


Pro ....etc

[:=Read Full Message Here=:]