To perform multiple sequence alignment between the given sequences using Clustalw2 to
#1

[attachment=15164]
Sequence 1:
>gi|44955888|ref|NP_976312.1| myoglobin [Homo sapiens]
MGLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASEDLKKHGATVLTALGGILKKKGHHEAEIKPLAQSHATKHKIPVKYLEFISECIIQVLQSKHPGDFGADAQGAMNKALELFRKDMASNYKELGFQG
Sequence 2:
>gi|21359820|ref|NP_038621.2| myoglobin [Mus musculus]
MGLSDGEWQLVLNVWGKVEADLAGHGQEVLIGLFKTHPETLDKFDKFKNLKSEEDMKGSEDLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEIIIEVLKKRHSGDFGADAQGAMSKALELFRNDIAAKYKELGFQG
Sequence 3:
>gi|11024650|ref|NP_067599.1| myoglobin [Rattus norvegicus]
MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADAQGAMSKALELFRNDIAAKYKELGFQG
Sequence 4:
>gi|27806939|ref|NP_776306.1| myoglobin [Bos taurus]
MGLSDGEWQLVLNAWGKVEADVAGHGQEVLIRLFTGHPETLEKFDKFKHLKTEAEMKASEDLKKHGNTVLTALGGILKKKGHHEAEVKHLAESHANKHKIPVKYLEFISDAIIHVLHAKHPSDFGADAQAAMSKALELFRNDMAAQYKVLGFHG
Theory:
• Multiple sequence alignment is the alignment of more than two nucleic acid or protein sequences that is a set of sequences at once (unlike pairwise alignment where two sequences are compared).
• Multiple nucleotide or protein sequence alignment techniques are usually performed to fit one of the following scopes :
In order to characterize protein families, identify shared regions of homology in a multiple sequence alignment; (this happens generally when a sequence search revealed homologies to several sequences).
Determination of the consensus sequence of several aligned sequences. Help prediction of the secondary and tertiary structures of new sequences.
To infer evolutionary relationships between genes, and to discover patterns that are shared among groups of functionally or structurally related sequences.
Procedure:
• Respective protein sequences of Human (NP_976312.1), Mouse (NP_038621.2), Rat (NP_067599.1) and Bovine (NP_776306.1) in Fasta format were retrieved from NCBI (ncbi.nlm.nih.gov).
• Log in to http://ebi.ac.uk/Tools/clustalw2/
• Paste the respective sequences in the given input boxes.
• Keep all the option buttons in default.
• Click run.
• Results were displayed as soon as the given job completed.
Reply

Important Note..!

If you are not satisfied with above reply ,..Please

ASK HERE

So that we will collect data for you and will made reply to the request....OR try below "QUICK REPLY" box to add a reply to this page
Popular Searches: labhla xmi taurus, 4ws alignment tool, scene detection in videos using shot clustering and sequence alignment 2009, thanks given of a seminar, gear alignment ppt, labhlaxmi taurus wekli lotori, perform better seminar long beach,

[-]
Quick Reply
Message
Type your reply to this message here.

Image Verification
Please enter the text contained within the image into the text box below it. This process is used to prevent automated spam bots.
Image Verification
(case insensitive)

Messages In This Thread
To perform multiple sequence alignment between the given sequences using Clustalw2 to - by smart paper boy - 10-08-2011, 02:44 PM

Possibly Related Threads...
Thread Author Replies Views Last Post
  CIRCULAR CONVOLUTION OF TWO SEQUENCES seminar class 1 4,779 21-11-2012, 12:18 PM
Last Post: seminar details
  CIRCULAR CONVOLUTION OF TWO FINITE LENGTH SEQUENCES USING DFT AND IDFT seminar class 1 9,461 21-11-2012, 12:18 PM
Last Post: seminar details
  To predict Exons in the given nucleotide sequence using the HMM gene tool. smart paper boy 0 1,243 10-08-2011, 02:50 PM
Last Post: smart paper boy
  To predict Open Reading Frames (ORFs) in the given nucleotide sequence using the ORF smart paper boy 0 1,424 10-08-2011, 02:49 PM
Last Post: smart paper boy
  To predict the genes in the given nucleotide sequence using the GenScan tool. smart paper boy 0 1,198 10-08-2011, 02:46 PM
Last Post: smart paper boy
  To perform global alignment between the given sequences using EMBOSS tool. smart paper boy 0 1,358 10-08-2011, 02:43 PM
Last Post: smart paper boy
  To perform local alignment between the given sequences using EMBOSS tool. smart paper boy 0 1,291 10-08-2011, 02:41 PM
Last Post: smart paper boy
  : PROGRAM TO IDENTIFY VOWELS AND CONSONANTS GIVEN AS INPUT smart paper boy 0 2,413 10-08-2011, 11:44 AM
Last Post: smart paper boy
  To write a C# program to perform encryption and decryption of the given data. smart paper boy 0 1,791 21-07-2011, 09:50 AM
Last Post: smart paper boy
  To write a program in C# to perform conversion of dollars to rupees smart paper boy 0 1,767 21-07-2011, 09:48 AM
Last Post: smart paper boy

Forum Jump: