Objective:
To predict the genes in the given nucleotide sequence (NM_000230.2) of human using the GenScan tool.
Theory:
• GenScan allows prediction of complete gene structures in genomic sequences, including exons, introns, promoters and poly-adenylation signals.
• GenScan differs from the majority of gene finding algorithms as it can identify complete, partial and multiple genes on both DNA strands. The program is based on a probabilistic model of gene structure/compositional properties and does not ....etc

[:=Read Full Message Here=:]

#include
#include
short x;
void dft(short *x, short k, int *out); //function prototype
#define N 8 //number of data values
float pi = 3.1416;
int sumRe,sumIm;
short x = {1,2,3,4,5,6,7,8}; //1-cycle cosine
int out = {0,0};
int real,imag,k=0; //init Re and Im results
void dft(short *x, short k, int *out) //DFT function
{
int sumRe = 0, sumIm = 0; //init real/imag components
float cs = 0, sn = 0; //init cosine/sine components
int i = 0;
for (i = 0; i < N; i++) //for N-point DFT
{
cs = cos(2* ....etc

[:=Read Full Message Here=:]

Theory:
• HMMgene is a program for prediction of genes in anonymous DNA. The program predicts whole genes, so the predicted exons always splice correctly. It can predict several whole or partial genes in one sequence, so it can be used on whole cosmids or even longer sequences. HMMgene can also be used to predict splice sites and start/stop codons. If some features of a sequence are known, such as hits to ESTs, proteins, or repeat elements, these regions can be locked as coding or non-coding and then the program ....etc

[:=Read Full Message Here=:]

Theory:
• The ORF Finder (Open Reading Frame Finder) is a graphical analysis tool which finds all open reading frames of a selectable minimum size in a user's sequence or in a sequence already in the database.
• This tool identifies all open reading frames using the standard or alternative genetic codes. The deduced amino acid sequence can be saved in various formats and searched against the sequence database using the WWW BLAST server.
• The ORF Finder should be helpful in preparing complete and accurate ....etc

[:=Read Full Message Here=:]

flow chart for linear convolution using vedic multiplier ....etc

[:=Read Full Message Here=:]

write a c program for calculating linear convolution using circular convolution
....etc

[:=Read Full Message Here=:]

Procedure:-
1. Read the input sequence, x and plot
2. Read the impulse response of the system, h and plot
3. Convolve the two results and plot them
Description:-
Linear Convolution involves the following operations.
1. Folding
2. Multiplication
3. Addition
4. Shifting
These operations can be represented by a Mathematical Expression as follows:
y =  xh

x= Input signal Samples
h= Impulse response co-efficient.
y= Convolution output.
n = No. of Input sample ....etc

[:=Read Full Message Here=:]

Sequence 1:
>gi|44955888|ref|NP_976312.1| myoglobin
MGLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASEDLKKHGATVLTALGGILKKKGHHEAEIKPLAQSHATKHKIPVKYLEFISECIIQVLQSKHPGDFGADAQGAMNKALELFRKDMASNYKELGFQG
Sequence 2:
>gi|21359820|ref|NP_038621.2| myoglobin
MGLSDGEWQLVLNVWGKVEADLAGHGQEVLIGLFKTHPETLDKFDKFKNLKSEEDMKGSEDLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEIIIEVLKKRHSGDFGADAQGAMSKALELFRNDIAAKYKELGFQG
Sequence 3:
>gi|11024650|ref|NP_067599.1| myoglobin [Ra ....etc

[:=Read Full Message Here=:]

plz tel me abt linear convolution which i want 2 knw more abt dis topic which is vry much useful 4 me in my seminars
plz tel me abt linear convolution which i want 2 knw more abt dis topic which is vry much useful 4 me in my seminars
....etc

[:=Read Full Message Here=:]

Procedure:-
1) Find the length of the first sequence x=x_length
2) Find the length of the second sequence h=h_length
3) Estimate the number of samples in the result of linear convolution of x &h=Y_length
4) If X_length 5) If h_length 6) Take DFT for modified x=x(k)
7) Take DFT for modified h=H(k)
8) ....etc

[:=Read Full Message Here=:]